Proteintech, 24976-1-AP, USP4 Polyclonal antibody

Size: 20ul / 150ul The USP4 (24976-1-AP) by Proteintech is a Polyclonal antibody targeting USP4 in WB, IHC, ELISA applications with reactivity to human samples 24976-1-AP targets USP4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, Jurkat cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information USP4, also known as UNP and UNPH, belongs to the peptidase C19 family and USP4 subfamily. USP4 is a deubiquitinating enzyme that links to mitogen-activated protein kinase signaling, pre-mRNA splicing, and control of p53 stability (PMID: 26455393). USP4 has 3 isoforms with the molecular mass of 36, 104 and 109 kDa. Recently, it has been reported that USP4 is a critical factor in promoting lung cancer stemness and potentially useful lung cancer prognosis marker (PMID: 32549341). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21684 Product name: Recombinant human USP4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 567-779 aa of BC125131 Sequence: VCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALR Predict reactive species Full Name: ubiquitin specific peptidase 4 (proto-oncogene) Calculated Molecular Weight: 963 aa, 109 kDa Observed Molecular Weight: 109 kDa GenBank Accession Number: BC125131 Gene Symbol: USP4 Gene ID (NCBI): 7375 RRID: AB_3085764 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13107 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.