Proteintech, 25049-1-AP, CCDC40 Polyclonal antibody

Size: 20ul / 150ul The CCDC40 (25049-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC40 in WB, ELISA applications with reactivity to human samples 25049-1-AP targets CCDC40 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue, A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20034 Product name: Recombinant human CCDC40 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 683-1031 aa of BC035251 Sequence: HTSSRLDAHQKTLVELDQDVKKVNELITNSQSEISRRTILIERKQGLINFLNKQLERMVSELGGEEVGPLELEIKRLSKLIDEHDGKAVQAQVTWLRLQQEMVKVTQEQEEQLASLDASKKELHIMEQKKLRVGSKIEQEKKEQKEIEHHMKDLDNDLKKLNMLMNKNRCSSEELEQNNRVTENEFVRSLKASERETIKMQDKLNQLSEEKATLLNQLVEAEHQIMLWEKKIQLAKEMRSSVDSEIGQTEIRAMKGEIHRMKKYCRTTRDARRHVHEQHGTRAGTCTNNTGRAQARARTTRDARRHVHEQHGTRAGTCTNNTGRAQARARTTRDARRHVHEHRTHTARA Predict reactive species Full Name: coiled-coil domain containing 40 Calculated Molecular Weight: 1142 aa, 130 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC035251 Gene Symbol: CCDC40 Gene ID (NCBI): 55036 RRID: AB_2879870 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4G0X9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.