Product Description
Size: 20ul / 150ul
The GALP (25116-1-AP) by Proteintech is a Polyclonal antibody targeting GALP in WB, ELISA applications with reactivity to human samples
25116-1-AP targets GALP in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: fetal human brain tissue, SH-SY5Y cells
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag18928 Product name: Recombinant human GALP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-116 aa of BC148722 Sequence: LGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS Predict reactive species
Full Name: galanin-like peptide
Calculated Molecular Weight: 116 aa, 13 kDa
Observed Molecular Weight: 5 kDa
GenBank Accession Number: BC148722
Gene Symbol: GALP
Gene ID (NCBI): 85569
RRID: AB_2879904
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UBC7
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924