Proteintech, 25148-1-AP, TBX15 Polyclonal antibody

Size: 20ul / 150ul The TBX15 (25148-1-AP) by Proteintech is a Polyclonal antibody targeting TBX15 in WB, ELISA applications with reactivity to human samples 25148-1-AP targets TBX15 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information TBX15 is a transcription factor from the T-box family and is a highly pleiotropic gene expressed in multiple tissues at different stages of development. It is required for skeletal development and deletions in this gene cause severe skeletal malformation. In addition, TBX15 also plays a role in the differentiation of brown and beige adipocytes (PMID: 28007980). The predicted molecular weight of TBX15 is 66 kDa. With modification, the MW of TBX15 will be migrated to 50 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18423 Product name: Recombinant human TBX15 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 227-496 aa of BC122553 Sequence: DFTTMQKQQGGSTGTSPTTSSTGTPSPSASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSGYNRLQSGTTSATQPSETFMPQRTPSLISGIPTPPSLPGNSKMEAYGGQLGSFPTSQFQYVMQAGNAASSSSSPHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPSGMEHSMHMISPSPNNQQATNTCDGRQYGAVPGSSSQMSVHMV Predict reactive species Full Name: T-box 15 Calculated Molecular Weight: 602 aa, 66 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC122553 Gene Symbol: TBX15 Gene ID (NCBI): 6913 RRID: AB_2879924 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96SF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.