Proteintech, 25151-1-AP, Syncoilin Polyclonal antibody

Size: 20ul / 150ul The Syncoilin (25151-1-AP) by Proteintech is a Polyclonal antibody targeting Syncoilin in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 25151-1-AP targets Syncoilin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: mouse heart tissue, human heart tissue, mouse skeletal muscle tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Syncoilin also known as SYNC1, is a member of the intermediate filament family with an N-terminal head domain, followed by a central coiled-coil region and a short C-terminal tail. Syncoilin is highly expressed in skeletal and cardiac muscle. In normal skeletal muscle, syncoilin is concentrated at the neuromuscular junction(PMID: 11053421). Western blot analysis detected 64 kDa and 55 kDa syncoilin proteins in mouse heart(PMID: 11053421). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18565 Product name: Recombinant human SYNC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 332-482 aa of BC119700 Sequence: MAESRQDLEEEYEPQFLRLLERKEAGTKALQRTQAEIQEMKEALRPLQAEARQLRLQNRNLEDQIALVRQKRDEEVQQYREQLEEMEERQRQLRNGVQLQQQKNKEMEQLRLSLAEELSTYKAMLLPKSLEQADAPTSQAGGMETQSQGAV Predict reactive species Full Name: syncoilin, intermediate filament protein Calculated Molecular Weight: 482 aa, 55 kDa Observed Molecular Weight: 64-68 kDa, 55 kDa GenBank Accession Number: BC119700 Gene Symbol: SYNC Gene ID (NCBI): 81493 RRID: AB_2879926 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H7C4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.