Proteintech, 25208-1-AP, TXNDC9 Polyclonal antibody

Size: 20ul / 150ul The TXNDC9 (25208-1-AP) by Proteintech is a Polyclonal antibody targeting TXNDC9 in WB, IF/ICC, ELISA applications with reactivity to human samples 25208-1-AP targets TXNDC9 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, HEK-293 cells, K-562 cells, HeLa cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TXNDC9, also known as APACD, has a negative effect on protein folding by significantly reducing the activity of chaperone protein TCP1 complex ATPase activity. Including actin or tubulin. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19509 Product name: Recombinant human TXNDC9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC005968 Sequence: MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD Predict reactive species Full Name: thioredoxin domain containing 9 Calculated Molecular Weight: 226 aa, 27 kDa Observed Molecular Weight: 25-27 kDa GenBank Accession Number: BC005968 Gene Symbol: TXNDC9 Gene ID (NCBI): 10190 RRID: AB_2879961 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14530 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.