Proteintech, 25251-1-AP, OPN5 Polyclonal antibody

Size: 20ul / 150ul The OPN5 (25251-1-AP) by Proteintech is a Polyclonal antibody targeting OPN5 in IF-P, ELISA applications with reactivity to human, mouse samples 25251-1-AP targets OPN5 in IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IF-P detected in: mouse eye tissue Recommended dilution Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Neuropsin (OPN5) is an opsin family member known as a photopigment responsive to wavelengths in the near-UV (λmax = 380 nm) (PMID: 31607531). In mammals, OPN5 is required to photoentrainment the local circadian oscillator in the murine retina and cornea (PMID: 21135214). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19384 Product name: Recombinant human OPN5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 263-354 aa of BC126198 Sequence: IAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEWE Predict reactive species Full Name: opsin 5 Calculated Molecular Weight: 354 aa, 40 kDa GenBank Accession Number: BC126198 Gene Symbol: OPN5 Gene ID (NCBI): 221391 RRID: AB_3669465 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6U736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.