Proteintech, 25314-1-AP, FGF17 Polyclonal antibody

Size: 20ul / 150ul The FGF17 (25314-1-AP) by Proteintech is a Polyclonal antibody targeting FGF17 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 25314-1-AP targets FGF17 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, PC-3 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17807 Product name: Recombinant human FGF17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-216 aa of BC105131 Sequence: AFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT Predict reactive species Full Name: fibroblast growth factor 17 Calculated Molecular Weight: 216 aa, 25 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC105131 Gene Symbol: FGF17 Gene ID (NCBI): 8822 RRID: AB_2880025 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60258 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.