Proteintech, 25343-1-AP, AGTR1 Polyclonal antibody

Size: 20ul / 150ul The AGTR1 (25343-1-AP) by Proteintech is a Polyclonal antibody targeting AGTR1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 25343-1-AP targets AGTR1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C2C12 cells, HT-1080 cells, mouse heart tissue, mouse kidney tissue, PC-12 cells, HEK-293 cells, HuH-7 cells Positive IHC detected in: mouse heart tissue, human liver cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Angiotensin II (Ang II), the main effector molecule of the renin-angiotensin system, exerts its actions mainly via interaction with type-1 angiotensin II receptor (AGTR1, also named AT1R), thereby contributing to blood pressure regulation. AGTR1 mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. By regulating vascular tone, cardiovascular function, and salt and water homeostasis, AGTR1 exerts an indispensable physiological role (PMID: 21600887). AGTR1 has been implicated in diverse aspects of human disease, from the regulation of blood pressure and cardiovascular homeostasis to cancer progression (PMID: 26975580). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14461 Product name: Recombinant human AGTR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 290-359 aa of BC022447 Sequence: IAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE Predict reactive species Full Name: angiotensin II receptor, type 1 Calculated Molecular Weight: 359 aa, 41 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC022447 Gene Symbol: AGTR1 Gene ID (NCBI): 185 RRID: AB_2880037 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30556 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.