Proteintech, 25435-1-AP, PLAC8L1 Polyclonal antibody

Size: 20ul / 150ul The PLAC8L1 (25435-1-AP) by Proteintech is a Polyclonal antibody targeting PLAC8L1 in IHC, ELISA applications with reactivity to human samples 25435-1-AP targets PLAC8L1 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22072 Product name: Recombinant human PLAC8L1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-177 aa of BC130588 Sequence: MNWFGSNFFRCPEDLSLLNIYSPLLSHMSSEDEHFISNLRGHVPASAVVKQPVRGASGRTTITAIVQTGGGWSTGLFSVCRDRRICFCGLFCPMCLECDIARHYGECLCWPLLPGSTFALRIGTRERHKIQGTLCEDWLAVHCCWAFSICQVARELKMRTSQVYEICAVPMTKDTLV Predict reactive species Full Name: PLAC8-like 1 Calculated Molecular Weight: 177 aa, 20 kDa GenBank Accession Number: BC130588 Gene Symbol: PLAC8L1 Gene ID (NCBI): 153770 RRID: AB_2880078 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A1L4L8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.