Proteintech, 25437-1-AP, KCTD16 Polyclonal antibody

Size: 20ul / 150ul The KCTD16 (25437-1-AP) by Proteintech is a Polyclonal antibody targeting KCTD16 in WB, ELISA applications with reactivity to human, mouse, rat samples 25437-1-AP targets KCTD16 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22064 Product name: Recombinant human KCTD16 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 318-396 aa of BC113435 Sequence: QSEASSPQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLSIEEELE Predict reactive species Full Name: potassium channel tetramerisation domain containing 16 Calculated Molecular Weight: 428 aa, 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC113435 Gene Symbol: KCTD16 Gene ID (NCBI): 57528 RRID: AB_2880079 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q68DU8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.