Proteintech, 25488-1-AP, CD164L2 Polyclonal antibody

Size: 20ul / 150ul The CD164L2 (25488-1-AP) by Proteintech is a Polyclonal antibody targeting CD164L2 in IHC, ELISA applications with reactivity to human samples 25488-1-AP targets CD164L2 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CD164L2 (CD164 sialomucin-like 2 protein) is a single-pass type I membrane protein and is located on the plasma membrane. There are few studies on this target, and its function needs further study. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22029 Product name: Recombinant human CD164L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-141 aa of BC137466 Sequence: GKGARGFGRGALIRLNIWPAVQGACKQLEVCEHCVEGDRARNLSSCMWEQCRPEEPGHCVAQSEVVKEGCSIYNRSEACPAAHHHPTYEPKTVTTGSPPVPEAHSPGFDGAS Predict reactive species Full Name: CD164 sialomucin-like 2 Calculated Molecular Weight: 174 aa, 18 kDa GenBank Accession Number: BC137466 Gene Symbol: CD164L2 Gene ID (NCBI): 388611 RRID: AB_3669479 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UWJ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.