Proteintech, 25500-1-AP, MATN3 Polyclonal antibody

Size: 20ul / 150ul The MATN3 (25500-1-AP) by Proteintech is a Polyclonal antibody targeting MATN3 in WB, IHC, ELISA applications with reactivity to human samples 25500-1-AP targets MATN3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human milk Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Matrilin-3 is a protein that in humans is encoded by the MATN3 gene. It is linked to the development of many types of cartilage, and part of the Matrilin family, which includes Matrilin-1, Matrilin-2, Matrilin-3, and Matrilin-4, a family of filamentous-forming adapter oligomeric extracellular proteins that are linked to the formation of cartilage and bone, as well as maintaining homeostasis after development. It is considered an extracellular matrix protein that functions as an adapter protein where the Matrilin-3 subunit can form both homo-tetramers and hetero-oligomers with subunits from Matrilin-1 which is the cartilage matrix protein. This restricted tissue has been strongly expressed in growing skeletal tissue as well as cartilage and bone.( PMID:26499313, 27104523, 11950247) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21932 Product name: Recombinant human MATN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 256-384 aa of BC139907 Sequence: SRFQETFCALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHHCECYEGYTLNAD Predict reactive species Full Name: matrilin 3 Calculated Molecular Weight: 486 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC139907 Gene Symbol: MATN3 Gene ID (NCBI): 4148 RRID: AB_3085799 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15232 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.