Proteintech, 25506-1-AP, TMEM74 Polyclonal antibody

Size: 20ul / 150ul The TMEM74 (25506-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM74 in IHC, ELISA applications with reactivity to human samples 25506-1-AP targets TMEM74 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Transmembrane protein 74 (TMEM74), plays an essential role in autophagy during cell starvation and other stress conditions. TMEM74 is localized to the lysosome and autophagosome. It has been reported that TMEM74-induced autophagy may be associated with PI3K signal transduction. (PMID: 19029833, 18294959) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22288 Product name: Recombinant human TMEM74 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC030710 Sequence: MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKLSSSPASPSSSLQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINLEQRNRSSPSAKGHNHPGELGWENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFISAILFLVT Predict reactive species Full Name: transmembrane protein 74 Calculated Molecular Weight: 305 aa, 33 kDa GenBank Accession Number: BC030710 Gene Symbol: TMEM74 Gene ID (NCBI): 157753 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96NL1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.