Proteintech, 25513-1-AP, MPZL3 Polyclonal antibody

Size: 20ul / 150ul The MPZL3 (25513-1-AP) by Proteintech is a Polyclonal antibody targeting MPZL3 in WB, ELISA applications with reactivity to human, mouse, rat samples 25513-1-AP targets MPZL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse brain tissue, rat liver tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information MPZL3 (Myelin protein zero-like protein 3) is a member of the myelin P0 protein family. The human MPZL3 gene is located at chromosome 11q23.3, and encodes a 235-amino acid polypeptide with an Immunoglobulin V-type (IgV) domain. MPZL3 protein is a membrane adhesion protein. It may be involved in immune function (PMID: 19054061). This polyclonal antibody raised against 32-235aa of human MPZL3 reveals bands of 28 kDa and 70 kDa, which could be endogenous MPZL3 of unmodified form and post-translational modified form, respectively (PMID: 17273165). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21905 Product name: Recombinant human MPZL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 32-235 aa of BC113586 Sequence: LEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY Predict reactive species Full Name: myelin protein zero-like 3 Calculated Molecular Weight: 235 aa, 26 kDa Observed Molecular Weight: 70 kDa, 28 kDa GenBank Accession Number: BC113586 Gene Symbol: MPZL3 Gene ID (NCBI): 196264 RRID: AB_2880111 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UWV2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.