Product Description
Size: 20ul / 150ul
The PABPC5 (25582-1-AP) by Proteintech is a Polyclonal antibody targeting PABPC5 in WB, IF/ICC, ELISA applications with reactivity to human samples
25582-1-AP targets PABPC5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A549 cells, SKOV-3 cells, U-251 cells
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22216 Product name: Recombinant human PABPC5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC063113 Sequence: MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRF Predict reactive species
Full Name: poly(A) binding protein, cytoplasmic 5
Calculated Molecular Weight: 382 aa, 43 kDa
Observed Molecular Weight: 37-43 kDa, 70 kDa
GenBank Accession Number: BC063113
Gene Symbol: PABPC5
Gene ID (NCBI): 140886
RRID: AB_3085806
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96DU9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924