Proteintech, 25681-1-AP, SPTBN1 Polyclonal antibody

Size: 20ul / 150ul The SPTBN1 (25681-1-AP) by Proteintech is a Polyclonal antibody targeting SPTBN1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 25681-1-AP targets SPTBN1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Caco-2 cells, mouse heart tissue, HEK-293 cells, SH-SY5Y cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information SPTBN1 is the non-erythrocytic form of β-spectrin or β-fodrin. Spectrins are members of the superfamily of F-actin cross linking proteins that are important as scaffolding proteins for protein sorting, cell adhesion, and migration. Reduced expression of SPTBN1 has been found to correlate with shorter survival of patients with hepatocellular cancer, pancreatic cancer and other malignancies of the gastrointestinal tract, suggesting tumor suppression ability of this protein. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22459 Product name: Recombinant human SPTBN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 633-820 aa of BC137282 Sequence: EMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKE Predict reactive species Full Name: spectrin, beta, non-erythrocytic 1 Calculated Molecular Weight: 2364 aa, 275 kDa Observed Molecular Weight: 275 kDa GenBank Accession Number: BC137282 Gene Symbol: SPTBN1 Gene ID (NCBI): 6711 RRID: AB_2880191 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01082 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.