Proteintech, 25717-1-AP, MAP6/STOP Polyclonal antibody

Size: 20ul / 150ul The MAP6/STOP (25717-1-AP) by Proteintech is a Polyclonal antibody targeting MAP6/STOP in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 25717-1-AP targets MAP6/STOP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse retina tissue, mouse brain tissue, mouse cerebellum tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MAP6, also named STOP protein, has been isolated from brain preparations but is also present in other tissues such as the skeletal muscles and heart. MAP6 is a calmodulin-binding and calmodulin-regulated protein that is involved in microtubule stabilization. Different isoforms of STOP protein arise from alternative mRNA splicing and transcription initiation sites using a single gene. The neuronal MAP6 isoforms N-STOP (120 kDa) and E-STOP (80 kDa), the astrocyte MAP6 isoform A-STOP (60 KDa), and a fibroblastic MAP6 isoform F-STOP (48 kDa) have been identified. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22471 Product name: Recombinant human MAP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-484 aa of BC139780 Sequence: GQGPMVQEPLKKQGSVVPGPPKDLGPMIPLPVKDQDHTVPEPLKNESPVISAPVKDQGPSVPVPPKNQSPMVPAKVKDQGSVVPESLKDQGPRIPEPVKNQAPMVPAPVKDEGPMVSASVKDQGPMVSAPVKDQGPIVPAPVKGEGPIVPAPVKDEGPMVSAPIKDQDPMVPEHPKDESAMATAPIKNQGSMVSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVAPVKNQGPVVPESVKNQDPILPVLVKDQGPTVLQPPKNQGRIVPEPLKNQVPIVPVPLKDQDPLVPVPAKDQGPAVPEPLKTQGPRDPQLPTVSPLPRVMIPTAPHTEYIESSP Predict reactive species Full Name: microtubule-associated protein 6 Calculated Molecular Weight: 813 aa, 87 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC139780 Gene Symbol: MAP6 Gene ID (NCBI): 4135 RRID: AB_3085819 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JE9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.