Product Description
Size: 20ul / 150ul
The LPPR2 (25732-1-AP) by Proteintech is a Polyclonal antibody targeting LPPR2 in WB, IHC, ELISA applications with reactivity to human, mouse samples
25732-1-AP targets LPPR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: 3T3-L1 cells, HeLa cells
Positive IHC detected in: human kidney tissue, human liver cancer tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:1000-1:4000
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag22839 Product name: Recombinant human LPPR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 272-343 aa of BC009378 Sequence: TGAAIATFLVTCVVHNFQSRPPSGRRLSPWEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTAPAVAT Predict reactive species
Full Name: lipid phosphate phosphatase-related protein type 2
Calculated Molecular Weight: 427 aa, 46 kDa
Observed Molecular Weight: 37 kDa
GenBank Accession Number: BC009378
Gene Symbol: LPPR2
Gene ID (NCBI): 64748
RRID: AB_2880215
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96GM1
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924