Proteintech, 25738-1-AP, ANKRD54 Polyclonal antibody

Size: 20ul / 150ul The ANKRD54 (25738-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD54 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25738-1-AP targets ANKRD54 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, K-562 cells, PC-3 cells Positive IHC detected in: mouse testis tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22759 Product name: Recombinant human ANKRD54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-300 aa of BC066909 Sequence: RVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR Predict reactive species Full Name: ankyrin repeat domain 54 Calculated Molecular Weight: 300 aa, 33 kDa Observed Molecular Weight: 33-35 kDa GenBank Accession Number: BC066909 Gene Symbol: ANKRD54 Gene ID (NCBI): 129138 RRID: AB_2880218 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NXT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.