Proteintech, 25871-1-AP, Progesterone Receptor Polyclonal antibody

Size: 20ul / 150ul The Progesterone Receptor (25871-1-AP) by Proteintech is a Polyclonal antibody targeting Progesterone Receptor in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 25871-1-AP targets Progesterone Receptor in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: T-47D cells Positive IHC detected in: human breast cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Positive IF/ICC detected in: T-47D cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PGR (Progesterone Receptor), also named as NR3C3 and PR, belongs to the nuclear hormone receptor family and NR3 subfamily. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Progesterone receptor isoform B (PRB) is involved activation of c-SRC/MAPK signaling on hormone stimulation. The ER and PR status has been used as a predictor of breast carcinoma responsiveness to endocrine therapy and as a prognostic indicator for early recurrence. This antibody recognizes both PR-A and PR-B. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22986 Product name: Recombinant human PR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of NM_000926 Sequence: MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTVM Predict reactive species Full Name: progesterone receptor Calculated Molecular Weight: 933 aa, 99 kDa Observed Molecular Weight: 80 kDa, 110-115 kDa GenBank Accession Number: NM_000926 Gene Symbol: Progesterone Receptor Gene ID (NCBI): 5241 RRID: AB_2880277 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06401 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.