Proteintech, 25872-1-AP, LY6G6F Polyclonal antibody

Size: 20ul / 150ul The LY6G6F (25872-1-AP) by Proteintech is a Polyclonal antibody targeting LY6G6F in WB, ELISA applications with reactivity to human samples 25872-1-AP targets LY6G6F in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HL-60 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information LY6G6F, also named as C6orf21, G6F, LY6G6D and NG32, plays a role in the downstream signal transduction pathways involving GRB2 and GRB7. It has monomer (~30 kda) and homodimer (~60 kDa). Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22467 Product name: Recombinant human LY6G6F protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-238 aa of BC137212 Sequence: DNMQAIYVALGEAVELPCPSPPTLHGDEHLSWFCSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSPCNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGVSFSLAASIDASPALCAPSTGWDMPWILM Predict reactive species Full Name: lymphocyte antigen 6 complex, locus G6F Calculated Molecular Weight: 297 aa, 32 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC137212 Gene Symbol: LY6G6F Gene ID (NCBI): 259215 RRID: AB_2880278 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5SQ64 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.