Proteintech, 25900-1-AP, ADAM10 Polyclonal antibody

Size: 20ul / 150ul The ADAM10 (25900-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM10 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25900-1-AP targets ADAM10 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human pancreas cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ADAM10, a member of the ADAM (a disintegrin and metalloprotease) family, is widely expressed in the brain, the spinal cord, and the visual system during development.MW of premature ADAM10 is 90 kDa and mature ADAM10 is 60-70 kDa (PMID: 24404179). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23078 Product name: Recombinant human ADAM10 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 306-512 aa of BC126253 Sequence: EQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGKQCSTVCIQVKV Predict reactive species Full Name: ADAM metallopeptidase domain 10 Calculated Molecular Weight: 748 aa, 84 kDa Observed Molecular Weight: 60-70 kDa, 90 kDa GenBank Accession Number: BC126253 Gene Symbol: ADAM10 Gene ID (NCBI): 102 RRID: AB_2880291 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14672 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.