Product Description
Size: 20ul / 150ul
The TRIM36 (25913-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM36 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples
25913-1-AP targets TRIM36 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse testis tissue
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Background Information
TRIM36, a member of the tripartite motif (TRIM) family of RING-containing proteins, also known as Haprin, is a microtubule-associated E3 ubiquitin ligase that plays a role in cytoskeletal organization, which was first discovered for its abundance in testis and found to be implicated in the spermatozoa acrosome reaction (PMID: 35053362, 30944633). TRIM36 was reported as a novel androgen signaling target gene and is upregulated in prostate cancer (PMID: 29449534).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23240 Product name: Recombinant human TRIM36 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-215 aa of BC130334 Sequence: ESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEH Predict reactive species
Full Name: tripartite motif-containing 36
Observed Molecular Weight: 83 kDa
GenBank Accession Number: BC130334
Gene Symbol: TRIM36
Gene ID (NCBI): 55521
RRID: AB_2880293
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NQ86
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924