Proteintech, 25913-1-AP, TRIM36 Polyclonal antibody

Size: 20ul / 150ul The TRIM36 (25913-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM36 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 25913-1-AP targets TRIM36 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information TRIM36, a member of the tripartite motif (TRIM) family of RING-containing proteins, also known as Haprin, is a microtubule-associated E3 ubiquitin ligase that plays a role in cytoskeletal organization, which was first discovered for its abundance in testis and found to be implicated in the spermatozoa acrosome reaction (PMID: 35053362, 30944633). TRIM36 was reported as a novel androgen signaling target gene and is upregulated in prostate cancer (PMID: 29449534). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23240 Product name: Recombinant human TRIM36 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 166-215 aa of BC130334 Sequence: ESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEH Predict reactive species Full Name: tripartite motif-containing 36 Observed Molecular Weight: 83 kDa GenBank Accession Number: BC130334 Gene Symbol: TRIM36 Gene ID (NCBI): 55521 RRID: AB_2880293 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQ86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.