Proteintech, 25987-1-AP, FAM120C Polyclonal antibody

Size: 20ul / 150ul The FAM120C (25987-1-AP) by Proteintech is a Polyclonal antibody targeting FAM120C in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 25987-1-AP targets FAM120C in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IP detected in: HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23235 Product name: Recombinant human FAM120C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-99 aa of BC136413 Sequence: TVSRQQQQQHLHRQLPPTAALAPGAPRAARGSVPLQPPLPPAALGAYSGGAGPTRHHHPAHHFHHHGQAQP Predict reactive species Full Name: family with sequence similarity 120C Observed Molecular Weight: 120 kDa GenBank Accession Number: BC136413 Gene Symbol: FAM120C Gene ID (NCBI): 54954 RRID: AB_2880321 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NX05 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.