Proteintech, 26038-1-AP, MLC1 Polyclonal antibody

Size: 20ul / 150ul The MLC1 (26038-1-AP) by Proteintech is a Polyclonal antibody targeting MLC1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26038-1-AP targets MLC1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23187 Product name: Recombinant human MLC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 325-377 aa of BC028425 Sequence: QCVRFKVSARLQGASWDTQNGPQERLAGEVARSPLKEFDKEKAWRAVVVQMAQ Predict reactive species Full Name: megalencephalic leukoencephalopathy with subcortical cysts 1 Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC028425 Gene Symbol: MLC1 Gene ID (NCBI): 23209 RRID: AB_3669518 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15049 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.