Proteintech, 26048-1-AP, IL-1 beta Polyclonal antibody

Size: 20ul / 150ul The IL-1 beta (26048-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1 beta in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26048-1-AP targets IL-1 beta in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, LPS and Brefeldin A treated NR8383 cells, LPS and Brefeldin A treated THP-1 cells Positive IF/ICC detected in: PMA, LPS and Brefeldin A treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit, monkey, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23461 Product name: Recombinant mouse IL-1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-269 aa of NM_008361 Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS Predict reactive species Full Name: interleukin 1 beta Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: NM_008361 Gene Symbol: IL-1 beta Gene ID (NCBI): 16176 RRID: AB_2880351 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10749 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.