Iright
BRAND / VENDOR: Proteintech

Proteintech, 26098-1-AP, MBTD1 Polyclonal antibody

CATALOG NUMBER: 26098-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MBTD1 (26098-1-AP) by Proteintech is a Polyclonal antibody targeting MBTD1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 26098-1-AP targets MBTD1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells, mouse spleen tissue, HL-60 cells Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22059 Product name: Recombinant human MBTD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-40 aa of BC101736 Sequence: MGTCWGDISENVRVEVPNTDCSLPTKVFWIAGIVKLAGYN Predict reactive species Full Name: mbt domain containing 1 Calculated Molecular Weight: 628 aa, 70 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC101736 Gene Symbol: MBTD1 Gene ID (NCBI): 54799 RRID: AB_2880374 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05BQ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924