Iright
BRAND / VENDOR: Proteintech

Proteintech, 26113-1-AP, C19orf20 Polyclonal antibody

CATALOG NUMBER: 26113-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C19orf20 (26113-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf20 in WB, ELISA applications with reactivity to human, mouse samples 26113-1-AP targets C19orf20 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human plasma tissue, mouse heart tissue, mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23546 Product name: Recombinant human C19orf20 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-255 aa of BC009520 Sequence: FENMGLRSPVNGGAGEPPGQLLLQQQRLGRALWHLRLAHHSQRAAFNNNVSVAYECLSAGGRRKRPGLDGRTYSELLRRICRDGQAPEEVVAPLLRKVQCRDHEAVPLSVFRAGTLTCFVLLEFVARAGALFQLLEDSAAAVADRRVGQAVLDTLEGALQASDAAAPARFLEAGSRLGPDSLALALDRAVGGRRPSAPMTREEFLERAAALFIAKVKPVG Predict reactive species Full Name: chromosome 19 open reading frame 20 Observed Molecular Weight: 29 kDa GenBank Accession Number: BC009520 Gene Symbol: C19orf20 Gene ID (NCBI): 91978 RRID: AB_2880385 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZTW0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924