Proteintech, 26127-1-AP, C9orf80 Polyclonal antibody

Size: 20ul / 150ul The C9orf80 (26127-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf80 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 26127-1-AP targets C9orf80 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information C9orf80 (INIP) is also a nuclear protein related to protein synthesis and transportation. C9orf80 is a member of the core hSSB1 complex, which plays an important role in DNA damage response and genome stability maintenance(PMID: 23986477). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23582 Product name: Recombinant human C9orf80 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC014881 Sequence: MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE Predict reactive species Full Name: chromosome 9 open reading frame 80 GenBank Accession Number: BC014881 Gene Symbol: C9orf80 Gene ID (NCBI): 58493 RRID: AB_3669523 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRY2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.