Product Description
Size: 20ul / 150ul
The PNLIPRP2 (26218-1-AP) by Proteintech is a Polyclonal antibody targeting PNLIPRP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
26218-1-AP targets PNLIPRP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse pancreas tissue, rat pancreas tissue
Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Immunohistochemistry (IHC): IHC : 1:100-1:400
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23967 Product name: Recombinant human PNLIPRP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 425-469 aa of BC005989 Sequence: RGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC Predict reactive species
Full Name: pancreatic lipase-related protein 2
Observed Molecular Weight: 52 kDa
GenBank Accession Number: BC005989
Gene Symbol: PNLIPRP2
Gene ID (NCBI): 5408
RRID: AB_2880430
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P54317
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924