Proteintech, 26228-1-AP, SCGB3A2 Polyclonal antibody

Size: 20ul / 150ul The SCGB3A2 (26228-1-AP) by Proteintech is a Polyclonal antibody targeting SCGB3A2 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 26228-1-AP targets SCGB3A2 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human lung tissue, mouse lung tissue, rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse lung tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23969 Product name: Recombinant human SCGB3A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 22-93 aa of BC024232 Sequence: FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV Predict reactive species Full Name: secretoglobin, family 3A, member 2 Calculated Molecular Weight: 10 kDa GenBank Accession Number: BC024232 Gene Symbol: SCGB3A2 Gene ID (NCBI): 117156 RRID: AB_2880434 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PL1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.