Iright
BRAND / VENDOR: Proteintech

Proteintech, 26232-1-AP, CPO Polyclonal antibody

CATALOG NUMBER: 26232-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CPO (26232-1-AP) by Proteintech is a Polyclonal antibody targeting CPO in WB, ELISA applications with reactivity to human samples 26232-1-AP targets CPO in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24059 Product name: Recombinant human CPO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC112078 Sequence: YDRSLAQHRQEIVDKSVSPWSLETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPIYYLKISQPSGNPKKII Predict reactive species Full Name: carboxypeptidase O Calculated Molecular Weight: 374 aa, 43 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC112078 Gene Symbol: CPO Gene ID (NCBI): 130749 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924