Proteintech, 26232-1-AP, CPO Polyclonal antibody

Size: 20ul / 150ul The CPO (26232-1-AP) by Proteintech is a Polyclonal antibody targeting CPO in WB, ELISA applications with reactivity to human samples 26232-1-AP targets CPO in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24059 Product name: Recombinant human CPO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC112078 Sequence: YDRSLAQHRQEIVDKSVSPWSLETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPIYYLKISQPSGNPKKII Predict reactive species Full Name: carboxypeptidase O Calculated Molecular Weight: 374 aa, 43 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC112078 Gene Symbol: CPO Gene ID (NCBI): 130749 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IVL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.