Proteintech, 26250-1-AP, TAOK1 Polyclonal antibody

Size: 20ul / 150ul The TAOK1 (26250-1-AP) by Proteintech is a Polyclonal antibody targeting TAOK1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 26250-1-AP targets TAOK1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse testis tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Thousand and one kinase 1 (TAOK1), also known as prostate-derived sterile 20 (Ste20)-like kinase 2, TAO1 (thousand and one amino-acid protein 1) or MARKK, is a member of the MAP3K protein kinase and belongs to the germinal-center kinase-like class of sterile 20 (Ste20)-like kinases (PMID: 29400705). TAOK1 is involved in mammalian brain development and functions as a negative regulator in IL-17-mediated signaling and inflammation (PMID: 33565190). TAOK1 has a calculated molecular mass of 116 kDa and encodes a serine/threonine protein kinase at its N terminus. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22461 Product name: Recombinant human TAOK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 890-1001 aa of BC133039 Sequence: MVLSNLSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSHMSYT Predict reactive species Full Name: TAO kinase 1 Calculated Molecular Weight: 1001 aa, 116 kDa Observed Molecular Weight: 116 kDa GenBank Accession Number: BC133039 Gene Symbol: TAOK1 Gene ID (NCBI): 57551 RRID: AB_2880446 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L7X3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.