Proteintech, 26330-1-AP, FAM134C Polyclonal antibody

Size: 20ul / 150ul The FAM134C (26330-1-AP) by Proteintech is a Polyclonal antibody targeting FAM134C in WB, IF/ICC, ELISA applications with reactivity to human samples 26330-1-AP targets FAM134C in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, HuH-7 cellls Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The protein family with sequence similarity 134 (FAM134) comprises three proteins: FAM134B, FAM134A, and FAM134C. These proteins share the same LIR amino acid sequence. FAM134C, also known as the reticulophagy regulator 3 (RETREG3), plays a crucial role as an ER-phagy receptor. It is essential for maintaining ER morphology in a LC3-interacting region (LIR)-dependent manner. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23680 Product name: Recombinant human FAM134C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-127 aa of BC049370 Sequence: MAEAEGVPTTPGPASGSTFRGRRDVSGSWERDQQVEAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALTSLRLVFLLAFGLMIIVCIDQWKNKIWPEIKVPRPDALDNESW Predict reactive species Full Name: family with sequence similarity 134, member C Observed Molecular Weight: 65 kDa GenBank Accession Number: BC049370 Gene Symbol: FAM134C Gene ID (NCBI): 162427 RRID: AB_3085859 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86VR2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.