Proteintech, 26478-1-AP, MINDY3 Polyclonal antibody

Size: 20ul / 150ul The MINDY3 (26478-1-AP) by Proteintech is a Polyclonal antibody targeting MINDY3 in IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 26478-1-AP targets MINDY3 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IP detected in: HCT 116 cells Positive IHC detected in: mouse kidney tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MINDY3 (also known as FAM63B) is a deubiquitinating enzyme (DUB) localized to the endoplasmic reticulum and belongs to the MINDY family. This protein specifically recognizes and cleaves lysine 48 (K48)-linked ubiquitin chains, which serve as the primary signal targeting proteins for proteasomal degradation, thereby playing a critical role in regulating protein stability. Research indicates that MINDY3 influences various cellular processes through its deubiquitination activity, including endoplasmic reticulum-associated degradation (ERAD), cellular stress response, and cell cycle regulation. Dysregulation of its function is closely associated with pathological processes such as cancer and neurodegenerative diseases, making it a potential target for therapeutic research. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23520 Product name: Recombinant human C10orf97 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-136 aa of BC067799 Sequence: MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSEKSSWRDCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHS Predict reactive species Full Name: chromosome 10 open reading frame 97 Observed Molecular Weight: 49 kDa GenBank Accession Number: BC067799 Gene Symbol: C10orf97 Gene ID (NCBI): 80013 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H8M7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.