Proteintech, 26576-1-AP, C9orf116 Polyclonal antibody

Size: 20ul / 150ul The C9orf116 (26576-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf116 in IHC, IF-P, ELISA applications with reactivity to mouse samples 26576-1-AP targets C9orf116 in IHC, IF-P, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23978 Product name: Recombinant human C9orf116 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC021261 Sequence: MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSNQAYGSRAPTVHEMPRV Predict reactive species Full Name: chromosome 9 open reading frame 116 GenBank Accession Number: BC021261 Gene Symbol: C9orf116 Gene ID (NCBI): 138162 RRID: AB_3669550 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5BN46 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.