Proteintech, 26596-1-AP, EPB41L4A Polyclonal antibody

Size: 20ul / 150ul The EPB41L4A (26596-1-AP) by Proteintech is a Polyclonal antibody targeting EPB41L4A in WB, ELISA applications with reactivity to human, mouse samples 26596-1-AP targets EPB41L4A in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:300-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23923 Product name: Recombinant human EPB41L4A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-106 aa of BC031042 Sequence: MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKL Predict reactive species Full Name: erythrocyte membrane protein band 4.1 like 4A Observed Molecular Weight: 36 kDa, 79 kDa GenBank Accession Number: BC031042 Gene Symbol: EPB41L4A Gene ID (NCBI): 64097 RRID: AB_2880569 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCS5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.