Product Description
Size: 20ul / 150ul
The EPB41L4A (26596-1-AP) by Proteintech is a Polyclonal antibody targeting EPB41L4A in WB, ELISA applications with reactivity to human, mouse samples
26596-1-AP targets EPB41L4A in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: NIH/3T3 cells, Transfected HEK-293 cells
Recommended dilution
Western Blot (WB): WB : 1:300-1:800
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23923 Product name: Recombinant human EPB41L4A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-106 aa of BC031042 Sequence: MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKL Predict reactive species
Full Name: erythrocyte membrane protein band 4.1 like 4A
Observed Molecular Weight: 36 kDa, 79 kDa
GenBank Accession Number: BC031042
Gene Symbol: EPB41L4A
Gene ID (NCBI): 64097
RRID: AB_2880569
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9HCS5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924