Iright
BRAND / VENDOR: Proteintech

Proteintech, 26596-1-AP, EPB41L4A Polyclonal antibody

CATALOG NUMBER: 26596-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EPB41L4A (26596-1-AP) by Proteintech is a Polyclonal antibody targeting EPB41L4A in WB, ELISA applications with reactivity to human, mouse samples 26596-1-AP targets EPB41L4A in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:300-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23923 Product name: Recombinant human EPB41L4A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-106 aa of BC031042 Sequence: MGCFCAVPEEFYCEVLLLDESKLTLTTQQQGIKKSTKGSVVLDHVFHHVNLVEIDYFGLRYCDRSHQTYWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKL Predict reactive species Full Name: erythrocyte membrane protein band 4.1 like 4A Observed Molecular Weight: 36 kDa, 79 kDa GenBank Accession Number: BC031042 Gene Symbol: EPB41L4A Gene ID (NCBI): 64097 RRID: AB_2880569 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCS5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924