Proteintech, 26598-1-AP, CRB1 Polyclonal antibody

Size: 20ul / 150ul The CRB1 (26598-1-AP) by Proteintech is a Polyclonal antibody targeting CRB1 in IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 26598-1-AP targets CRB1 in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse eye tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information CRB1, also known as protein crumbs homolog 1, is homologous to Drosophila Crumbs, a protein that is essential for establishing and maintaining apico-basal polarity in epithelia derived from the ectoderm (PMID: 2344615). CRB1 protein is a single transmembrane protein with a large extracellular part, containing three laminin A G domains and 19 epidermal growth-factor-like domains (PMID: 15494026, 18407265, 11734541). The expression of CRB1 is restricted to the retina and brain (PMID: 10508521). Mutations in CRB1 gene cause severe retinal dystrophies, ranging from retinitis pigmentosa (RP) to Leber congenital amaurosis (LCA) (PMID: 11734541). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24512 Product name: Recombinant human CRB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-188 aa of BC136271 Sequence: NNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQGRHCDLEVD Predict reactive species Full Name: crumbs homolog 1 (Drosophila) Calculated Molecular Weight: 1406 aa, 154 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC136271 Gene Symbol: CRB1 Gene ID (NCBI): 23418 RRID: AB_2918104 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P82279 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.