Proteintech, 26637-1-AP, JMJD1C Polyclonal antibody

Size: 20ul / 150ul The JMJD1C (26637-1-AP) by Proteintech is a Polyclonal antibody targeting JMJD1C in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 26637-1-AP targets JMJD1C in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: U-251 cells, NIH/3T3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information JMJD1C, a member of the lysine demethylase 3 (KDM3) family, is universally required for the survival of several types of acute myeloid leukemia (AML) cells with different genetic mutations. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24348 Product name: Recombinant human JMJD1C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-138 aa of BC143722 Sequence: TGIITHHDLFTRTMIVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSDSS Predict reactive species Full Name: jumonji domain containing 1C Calculated Molecular Weight: 2358 aa, 263 kDa Observed Molecular Weight: 285 kDa GenBank Accession Number: BC143722 Gene Symbol: JMJD1C Gene ID (NCBI): 221037 RRID: AB_3669557 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15652 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.