Product Description
Size: 20ul / 150ul
The MTERFD3 (26676-1-AP) by Proteintech is a Polyclonal antibody targeting MTERFD3 in WB, ELISA applications with reactivity to human samples
26676-1-AP targets MTERFD3 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: SH-SY5Y cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24704 Product name: Recombinant human MTERFD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 299-385 aa of BC025984 Sequence: LEERMQGLLREGISIAQIRETPMVLELTPQIVQYRIRKLNSSGYRIKDGHLANLNGSKKEFEANFGKIQAKKVRPLFNPVAPLNVEE Predict reactive species
Full Name: MTERF domain containing 3
Calculated Molecular Weight: 385 aa, 44 kDa
Observed Molecular Weight: 44-50 kDa
GenBank Accession Number: BC025984
Gene Symbol: MTERFD3
Gene ID (NCBI): 80298
RRID: AB_2880597
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q49AM1
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924