Proteintech, 26716-1-AP, Alpha-1-microglobulin Polyclonal antibody

Size: 20ul / 150ul The Alpha-1-microglobulin (26716-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha-1-microglobulin in WB, IHC, ELISA applications with reactivity to human samples 26716-1-AP targets Alpha-1-microglobulin in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma, human urine Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Alpha-1-microglobulin (A1M) is also named as Protein AMBP, Bikunin, Trypstatin and Inter-alpha-trypsin inhibitor light chain (ITI-LC). A1M belongs to the lipocalin protein family, a group of structural proteins with a similar one-domain fold that are found in bacteria, plants and animals (PMID: 2580349). A1M is recognized as a physiological antioxidant with powerful cell- and tissue-protective properties (PMID: 11877257). Whereas A1M is a heme and radical scavenger, and a reductase, bikunin is a structural component of extracellular matrix and has protease inhibitor and anti-inflammatory properties (PMID: 27988357). In humans, the majority of A1M is synthesized in the liver, but smaller quantities are also expressed in most other cells in the body. In the blood, equal quantities of two forms of A1M can be found: a free monomeric form and a covalent high-molecular weight complex bound to immunoglobulin A, albumin and prothrombin (PMID: 6196366, PMID: 9183005). Endogenous A1M has also been described to be localized ubiquitously in the dermal and epidermal layers of skin, and in syncytiothrophoblasts, monocytes/macrophages, vascular endothelium and extracellular matrix of placental tissue and extracellular matrix (PMID: 22096585,PMID: 21356557). Alpha 1 microglobulin, also known as HI30, is a 27-30 kDa glycoprotein, present in various body fluids. It belongs to the lipocalin superfamily of hydrophobic ligand-binding proteins forming an internal ligand-binding pocket. The protein acts as a mediator of bacterial adhesion to polymer surfaces and is involved in inhibiting renal lithogenesis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25239 Product name: Recombinant human AMBP protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 21-352 aa of BC041593 Sequence: PVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN Predict reactive species Full Name: alpha-1-microglobulin/bikunin precursor Calculated Molecular Weight: 352 aa, 39 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC041593 Gene Symbol: Alpha 1 microglobulin Gene ID (NCBI): 259 RRID: AB_3085894 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02760 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.