Proteintech, 26783-1-AP, NaPi-IIa Polyclonal antibody

Size: 20ul / 150ul The NaPi-IIa (26783-1-AP) by Proteintech is a Polyclonal antibody targeting NaPi-IIa in WB, ELISA applications with reactivity to human, mouse, rat samples 26783-1-AP targets NaPi-IIa in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse lung tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information NaPi-IIa, also known as Npt2a (SLC34A1), is an electrogenic Na+-dependent Pi cotransporter expressed in the brush border membranes (BBM) of renal proximal tubules. NaPi-IIa could be detected with an apparent molecular weight 75 kDa, corresponding to the full length glycosylated protein, together with a lower molecular weight 37 kDa known to be a N-terminal proteolytic fragment which is also glycosylated (PMID:36074191). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24807 Product name: Recombinant human SLC34A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC053349 Sequence: MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQAGAMLLK Predict reactive species Full Name: solute carrier family 34 (sodium phosphate), member 1 Observed Molecular Weight: 70-75 kDa, 30-35 kDa GenBank Accession Number: BC053349 Gene Symbol: SLC34A1 Gene ID (NCBI): 6569 RRID: AB_3085903 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q06495 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.