Proteintech, 26845-1-AP, TRAF1 Polyclonal antibody

Size: 20ul / 150ul The TRAF1 (26845-1-AP) by Proteintech is a Polyclonal antibody targeting TRAF1 in IHC, IF/ICC, ELISA applications with reactivity to human samples 26845-1-AP targets TRAF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HUVEC cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25397 Product name: Recombinant human TRAF1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 173-295 aa of BC024145 Sequence: QEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPA Predict reactive species Full Name: TNF receptor-associated factor 1 Calculated Molecular Weight: 416 aa, 46 kDa GenBank Accession Number: BC024145 Gene Symbol: TRAF1 Gene ID (NCBI): 7185 RRID: AB_2880655 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13077 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.