Proteintech, 26875-1-AP, H2AFY Polyclonal antibody

Size: 20ul / 150ul The H2AFY (26875-1-AP) by Proteintech is a Polyclonal antibody targeting H2AFY in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26875-1-AP targets H2AFY in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, Caco-2 cells, mouse brain tissue, HeLa cells, rat brain Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25445 Product name: Recombinant human H2AFY protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 123-235 aa of BC013331 Sequence: KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEK Predict reactive species Full Name: H2A histone family, member Y Calculated Molecular Weight: 372 aa, 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC013331 Gene Symbol: H2AFY Gene ID (NCBI): 9555 RRID: AB_2918113 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75367 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.