Proteintech, 26948-1-AP, USP7 Polyclonal antibody

Size: 20ul / 150ul The USP7 (26948-1-AP) by Proteintech is a Polyclonal antibody targeting USP7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26948-1-AP targets USP7 in WB, IHC, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, U2OS cells, K-562 cells, mouse spleen tissue, NIH/3T3 cells, PC-12 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25634 Product name: Recombinant human USP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-93 aa of Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK Predict reactive species Full Name: ubiquitin specific peptidase 7 (herpes virus-associated) Observed Molecular Weight: 126-128 kDa Gene Symbol: USP7 Gene ID (NCBI): 7874 RRID: AB_2880696 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q93009 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.