Product Description
Size: 20ul / 150ul
The MCT14 (26953-1-AP) by Proteintech is a Polyclonal antibody targeting MCT14 in WB, ELISA applications with reactivity to human, pig, mouse samples
26953-1-AP targets MCT14 in WB, ELISA applications and shows reactivity with human, pig, mouse samples.
Tested Applications
Positive WB detected in: Caco-2 cells, pig kidney tissue, SH-SY5Y cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Specification
Tested Reactivity: human, pig, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25315 Product name: Recombinant human SLC16A14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 212-312 aa of BC065524 Sequence: LSPGKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKDGGLGNEETLCDLQAQECPDQAGHRKNMCALRILKTVSWLTMRVRKGFEDWYSGYFGTASLFT Predict reactive species
Full Name: solute carrier family 16, member 14 (monocarboxylic acid transporter 14)
Calculated Molecular Weight: 510 aa, 56 kDa
Observed Molecular Weight: 42-52 kDa
GenBank Accession Number: BC065524
Gene Symbol: MCT14
Gene ID (NCBI): 151473
RRID: AB_2880701
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q7RTX9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924