Proteintech, 26958-1-AP, SLC2A12 Polyclonal antibody

Size: 20ul / 150ul The SLC2A12 (26958-1-AP) by Proteintech is a Polyclonal antibody targeting SLC2A12 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26958-1-AP targets SLC2A12 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue, unboiled mouse heart tissue Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC2A12 encodes glucose transporter type 12 (GLUT12), a basal and insulin-independent glucose transporter in the heart with previously reported associations with idiopathic dilated cardiomyopathy in humans, as well as insulin resistance and kidney disease in animal models (PMID: 37081215). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24979 Product name: Recombinant human SLC2A12 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 550-617 aa of BC070149 Sequence: PETKGCSLEQISMELAKVNYVKNNICFMSHHQEELVPKQPQKRKPQEQLLECNKLCGRGQSRQLSPET Predict reactive species Full Name: solute carrier family 2 (facilitated glucose transporter), member 12 Calculated Molecular Weight: 617 aa, 67 kDa Observed Molecular Weight: 67-70 kDa GenBank Accession Number: BC070149 Gene Symbol: SLC2A12 Gene ID (NCBI): 154091 RRID: AB_3085917 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TD20 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.