Proteintech, 26975-1-AP, NeuN Polyclonal antibody

Size: 20ul / 150ul The NeuN (26975-1-AP) by Proteintech is a Polyclonal antibody targeting NeuN in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples 26975-1-AP targets NeuN in WB, IHC, IF-P, IF-Fro, FC (Intra), Dot blot, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, mouse cerebellum tissue, rat cerebellum tissue Positive IHC detected in: mouse cerebellum tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue, rat cerebellum tissue, mouse cerebellum tissue Positive IF-Fro detected in: mouse brain tissue Positive FC (Intra) detected in: U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:5000-1:30000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information FunctionNeuN, also known as FOX3 or RBFOX3, belongs to a family of tissue-specific splicing regulators and is involved in neural circuitry balance, as well as neurogenesis and synaptogenesis (PMID: 26619789).Tissue specificityNeuN is exclusively present in post-mitotic neurons and is absent from neural progenitors, oligodendrocytes, astrocytes, and glia (PMID: 1483388).Involvement in disease·NeuN cytoplasmic localization is increased in the neurons of patients with HIV-associated neurocognitive disorders (PMID: 24215932).IsoformsThere are 4 isoforms of NeuN, migrating in the 45-50 kDa range (PMID: 21747913).Post-translational modificationsCurrently not known.Cellular localizationNeuN predominantly localizes to the nucleus but can also be present in the cytoplasm. Isoforms of NeuN differ in their cytoplasmic/nucleus localization (PMID: 21747913). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig, monkey, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25689 Product name: Recombinant human NeuN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species Full Name: hexaribonucleotide binding protein 3 Observed Molecular Weight: 46-52 kDa GenBank Accession Number: NM_001082575 Gene Symbol: NeuN Gene ID (NCBI): 146713 RRID: AB_2880708 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A6NFN3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.