Proteintech, 27041-1-AP, TAF5 Polyclonal antibody

Size: 20ul / 150ul The TAF5 (27041-1-AP) by Proteintech is a Polyclonal antibody targeting TAF5 in WB, ELISA applications with reactivity to human samples 27041-1-AP targets TAF5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25742 Product name: Recombinant human TAF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 655-800 aa of BC136348 Sequence: DVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ Predict reactive species Full Name: TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa Calculated Molecular Weight: 87 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC136348 Gene Symbol: TAF5 Gene ID (NCBI): 6877 RRID: AB_3669582 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15542 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.